PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010093958.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family HB-other
Protein Properties Length: 1716aa    MW: 192912 Da    PI: 5.3244
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010093958.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.72e-181874157
                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                    + kR   t++qle+Le+ ++++ yps++ r+eL+ klgL++rq ++WF+ rR k++k
  XP_010093958.1 18 KNKRKMKTASQLEILEKTYAEEAYPSESLRAELSVKLGLSDRQLQMWFCHRRLKDRK 74
                    679****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.3E-18474IPR009057Homeodomain-like
SuperFamilySSF466892.35E-151374IPR009057Homeodomain-like
PROSITE profilePS5007116.9081575IPR001356Homeobox domain
SMARTSM003892.4E-161779IPR001356Homeobox domain
CDDcd000861.10E-131874No hitNo description
PfamPF000464.6E-161874IPR001356Homeobox domain
SMARTSM005711.4E-20516575IPR018501DDT domain
PROSITE profilePS5082716.574516575IPR018501DDT domain
PfamPF027914.4E-17518572IPR018501DDT domain
PfamPF050662.2E-15698766IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156122.0E-8909947IPR028942WHIM1 domain
PfamPF156131.7E-1210911163IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1716 aa     Download sequence    Send to blast
MEAGSEGEKK KPPEGENKNK RKMKTASQLE ILEKTYAEEA YPSESLRAEL SVKLGLSDRQ  60
LQMWFCHRRL KDRKATPTPA KRPRKDSLGA AGFAGGSGEE LAAGDLGNEH GSGPVPGPST  120
FGHFVEPQRI APRHRGAGPR AGGDMLPAMK RYYEPQQTNP ELRAIAFVEA QLGDPLREDG  180
PILGMEFDPL PPDAFGAPIG AAMVGQHKQS GRPFDAKIYD RSDAKSVKGT TRALHEYQFI  240
PEQPSVRTET YERRAPSYHY GSPADGPNGR TSSLSTGHMY LHGNEHLSAG YGFQDAYLGT  300
HPVHQLENPF IAPDRRVINE EDNSRIERKR KSEEARLARE VEAHEKRIRK ELEKQDILRR  360
KREEQIRKEM ERHDRERRKE EERLLREKQR EEERYQREQR RELERREKFL QKESIRVEKM  420
KQKEELRREK EAARLRAAHE RAIARRIAKE SMELIEDERL ELMELAASSK GLPSILSLDY  480
EILQNLELYR EMQTAFPPKS VHLKKPFAIQ PWIYSEDNIG SLLMVWRFLI TFADVLGLWP  540
FTLDEFIQAF HDYDTRLLGE IHISLLRSII KDIEDVARTP STGLGANQTS AANPGGGHPL  600
IVEGAYSWGF DIRSWQRHLN PLTWPEILRQ FALSAGFGPQ LKKRNIEPSY VRDDNEGNDG  660
EDIVSNLRSG AAVENAFAKM QERGFSNPRR SRHRLTPGTV KFAAFHVLSL EGERGLTILE  720
VADRIQKSGL RDLTTSKTPE ASIAAALSRD TKLFERTAPS TYCVRAAYRK DPSDAEAILS  780
AARERIGTFK SGFLDGEDAD DGERDEDSES DVAEDPEIDD LGTEINPERS VQGSQEVNKL  840
DVISLLENGK GSVEVIEMPE KVLQNIGESC VKTKEPYSSF GQSVDIIGSC NDASIVDHED  900
ADIDESNPGE PWVQGLIEGD YSDLSVEERL KALVAIIGVA VEGNSIRLVL EERLEAANAL  960
KKQMWAGVQL DKRRMKEEYV MRMHCSSIMV NKLEPNLAYT SAGSRQSPFV TVDDKNNKTT  1020
ENLGVQEERI SDPPDDSLHV SSFPSEGNLQ MQEVSAAENH VSQQPGYAVE RTRSQLKSYI  1080
GHKAEEMYVY RSLPLGQDRR RNRYWQFITS ASQNDPGCGR IFVELYDGRW RLIDSEEGFD  1140
VLLASLDIRG VRESHLQMML QKVEISFKKA VRKKMLHANV RKQSEDAKLE AFETTPHPNF  1200
SIRPDSPSST LCSANSDVSE SSTSFEIELG RNKNESNGAL KRYQDLERWI WKECYSSSML  1260
CAIKQGKKRC KQLLEICDDC HSIYSSEEDH CPSCHMTYGT LERGIRFSEH VAQCIEERKV  1320
SVPSEALQSL WTRSCRESWG VRVNTSSSAE DLLQVLTLLE GAIKREFLFS DFETTSELLE  1380
SLNPGRYAVT SSHSLETVAV LPWVPRTSAA VALRVMEFDA AIFYVPRQKV ESQKDKGSDV  1440
ILSSRYAVGK SPLDETMRTP GQGYHLKEDY WPDLGLGLAD PDIGKGIRGR GRGRTRGNRS  1500
QRRAIGSTSR GDTAKKSNGI LGQGLGWKGR QRGRGRKRGR RSIRSRAKPA KRMVKTDVVK  1560
NNPEEKVSKK APSLVQKWNA EDTTGFQLEG AEPASSSGRS EYDGENGEGS GDEYEDTAVD  1620
DYASGFNSKS GDLEGSDYNV DGVEEIDGDD DVEGYDAREG YDAGEGYDIG EDEQEDFDVD  1680
RYIDGDSEDE ENRVGEVGQN MELGQDSGSP SSDYSQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115291539RQRGRGRKRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4384134e-46AM438413.2 Vitis vinifera contig VV78X112028.12, whole genome shotgun sequence.
GenBankAM4574734e-46AM457473.2 Vitis vinifera contig VV78X112028.14, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010093958.10.0Homeobox protein
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLW9R3000.0W9R300_9R
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25233369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator